PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000256514
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 371aa    MW: 41144.2 Da    PI: 5.8017
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000256514genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.42.9e-33191249159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK vk+s++prsYYrCt+agC vkk+ver ++dp++v++tYeg+H+h+
  MDP0000256514 191 LDDGYRWRKYGQKAVKNSPYPRSYYRCTTAGCGVKKRVERLSDDPSTVVTTYEGQHTHP 249
                    59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.9E-35176251IPR003657WRKY domain
SuperFamilySSF1182908.5E-30183251IPR003657WRKY domain
PROSITE profilePS5081132.822186251IPR003657WRKY domain
SMARTSM007743.0E-40191250IPR003657WRKY domain
PfamPF031064.5E-27192249IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MDGREEELKT TDRSNGMEYS TVFSDEIPTN FPSFSGMFDM PSSGEDQKVS MGGFMDLHGI  60
PDYAPSLFDF TQTTSSLMMM PPHHHQQQSL PPTSTVVALP ERDSATTTNT TSEILNSSTA  120
PTTPNSSSIS SSSNEAAANN NEGQITKLQE EEADEQDPEK TQKQLKPKKK NQKRQREPRF  180
AFMTKSEVDN LDDGYRWRKY GQKAVKNSPY PRSYYRCTTA GCGVKKRVER LSDDPSTVVT  240
TYEGQHTHPS PITQRGTMGI ARLPDQSTGF ISAAASSNPF AVQQFLPHHR HYQQQQQQQQ  300
QQYGYMYQSS PSLNISSSPY GGGSDGGPFN ISSFSTGLLQ ERDILEGPAF SSSASNFLKD  360
HGLLQDMVPQ I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A3e-281842511077Probable WRKY transcription factor 4
1wj2_A3e-281842511077Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.159770.0bud| fruit| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008340588.10.0PREDICTED: probable WRKY transcription factor 48
SwissprotQ9FGZ44e-54WRK48_ARATH; Probable WRKY transcription factor 48
TrEMBLD9ZJG10.0D9ZJG1_MALDO; WRKY domain class transcription factor
STRINGVIT_05s0077g00730.t014e-78(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100234114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49520.12e-48WRKY DNA-binding protein 48